PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MDP0000232454
Common NameMYB33
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Malus
Family MYB
Protein Properties Length: 190aa    MW: 20914.6 Da    PI: 9.7763
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MDP0000232454genomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.71.5e-191257147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     +g+W++eEd+ l ++v+++G+++W++I++ ++ gR++k+c++rw + 
    MDP0000232454 12 KGPWSPEEDDSLQKLVQKHGPRNWSLISKSIP-GRSGKSCRLRWCNQ 57
                     79******************************.***********985 PP

2Myb_DNA-binding56.75.6e-1866108347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      ++T+eEd+ +++a++++G++ W+tIar ++ gRt++ +k++w++ 
    MDP0000232454  66 AFTPEEDDTIIRAHARFGNK-WATIARLLN-GRTDNAIKNHWNST 108
                      79******************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129426.661762IPR017930Myb domain
SuperFamilySSF466891.47E-329105IPR009057Homeodomain-like
SMARTSM007171.5E-161160IPR001005SANT/Myb domain
PfamPF002491.9E-191257IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-261365IPR009057Homeodomain-like
CDDcd001673.42E-161456No hitNo description
SMARTSM007179.2E-1563111IPR001005SANT/Myb domain
PROSITE profilePS5129420.99664113IPR017930Myb domain
CDDcd001671.52E-1266109No hitNo description
Gene3DG3DSA:1.10.10.609.4E-2466112IPR009057Homeodomain-like
PfamPF002499.8E-1666108IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MAVIRKDMDR IKGPWSPEED DSLQKLVQKH GPRNWSLISK SIPGRSGKSC RLRWCNQLSP  60
QVEHRAFTPE EDDTIIRAHA RFGNKWATIA RLLNGRTDNA IKNHWNSTLK RKCSDVGGVV  120
LNGGYDGHYL LDHEQPPLKR SVSAGSGVPV STGLYMSPGS PSGSDVSDSS VQVMSLPDCH  180
VYRPVARSGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1mse_C4e-42111133105C-Myb DNA-Binding Domain
1msf_C4e-42111133105C-Myb DNA-Binding Domain
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mdo.113560.0bud| fruit| leaf
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankDQ0744610.0DQ074461.1 Malus x domestica MYB6 mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008391509.11e-140PREDICTED: transcription factor MYB44-like
SwissprotQ9FDW11e-86MYB44_ARATH; Transcription factor MYB44
TrEMBLD9ZJ611e-134D9ZJ61_MALDO; MYB domain class transcription factor
STRINGPOPTR_0005s18620.11e-104(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF84334124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37260.12e-85myb domain protein 73